PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013583693.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 254aa    MW: 28872.5 Da    PI: 7.1289
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013583693.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.38.6e-093277447
                     S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                     WT+eE + + +a + ++ +   +W +Ia++++ g+t  ++   ++k+
   XP_013583693.1 32 WTKEENKMFERALAIYPEDspdRWFKIASMIP-GKTVFDVMKQYNKL 77
                     ********************************.**********9997 PP

2Myb_DNA-binding409.3e-13124168347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ +  ++G+g+W+ I+r +   +t+ q+ s+ qky
   XP_013583693.1 124 PWTEEEHRRFLLGLLKYGKGDWRNISRNFVVSKTPTQVASHAQKY 168
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.1792782IPR017884SANT domain
SMARTSM007171.5E-92880IPR001005SANT/Myb domain
SuperFamilySSF466895.38E-133085IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-43177IPR009057Homeodomain-like
CDDcd001671.26E-93277No hitNo description
PfamPF002491.7E-73277IPR001005SANT/Myb domain
PROSITE profilePS5129419.439117173IPR017930Myb domain
SuperFamilySSF466892.28E-15119172IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-17120172IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.0E-11121173IPR009057Homeodomain-like
SMARTSM007171.7E-10121171IPR001005SANT/Myb domain
CDDcd001673.75E-9124168No hitNo description
PfamPF002494.0E-10124168IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
METLKPLSHV PISDYRFVGQ DMMSLQSPSS IWTKEENKMF ERALAIYPED SPDRWFKIAS  60
MIPGKTVFDV MKQYNKLEED VFDIEEGRVP IPGYPSPLGF AQDTCRKRPN GARGSDHDRK  120
KGVPWTEEEH RRFLLGLLKY GKGDWRNISR NFVVSKTPTQ VASHAQKYYQ RQLSGAKDKR  180
RPSIHDITTG NLLNANLNRS FSDHRDILLD LGFIENDNAE EGLMCMSQNP FCPSSAPFDA  240
AFNFAGVNAY SDGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-162299178RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0561800.0AY056180.1 Arabidopsis thaliana putative MYB-family transcription factor (At3g11280) mRNA, complete cds.
GenBankAY0912650.0AY091265.1 Arabidopsis thaliana putative MYB-family transcription factor (At3g11280) mRNA, complete cds.
GenBankAY5503080.0AY550308.1 Arabidopsis thaliana MYB transcription factor (At3g11280) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013583693.10.0PREDICTED: transcription factor DIVARICATA isoform X1
SwissprotQ8S9H78e-70DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D3CL820.0A0A0D3CL82_BRAOL; Uncharacterized protein
STRINGBra034853.1-P1e-164(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43402657
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.21e-154MYB family protein